From the business
Access over 2 billion public records from thousands of federal, state, city and municipal sources
Records Finder Reviews Summary
Records Finder has a rating of 3.7 stars from 7,918 reviews, indicating that most customers are generally satisfied with their purchases. Reviewers satisfied with Records Finder most frequently mention customer service, easy access and accurate information. Records Finder ranks 4th among Government Records sites.
Nice………………………………………………….,,,,,,,,,,,……………….,,,,,,,,,
Hello Adam,
Thank you for your feedback! We appreciate your positive response. If you have any specific comments or suggestions you'd like to share, we'd love to hear them to further improve our services. Your input is valuable to us!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Search only took a few minutes and received all the info I was needing
Hello Rena,
I'm glad to hear that your search was efficient and successful! If you have any more questions or if there's anything else I can help you with, feel free to let me know. Happy to assist!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Good so far I have had an amazing experience doing this
Hello Brien,
Thank you for taking the time to share your feedback with us! We're delighted to hear that you've had an amazing experience so far. Your satisfaction is our priority, and we're committed to ensuring that your experience continues to be positive and enjoyable.
If there is anything else we can help you with, please do not hesitate to reach out. Once again, thank you for choosing us, and we look forward to continuing to provide you with an amazing experience.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
So kind and immediately took care of the issue. Not only resolved it right away but made sure I had record of it as well! He is an excellent addition to your staff and should be teaching other representatives how to take calls and train.
Hello Jouleyanne,
Thank you so much for your incredibly kind and appreciative words! We're delighted to hear about your positive experience with our representative. Providing excellent service and prompt issue resolution is always our top priority.
Your feedback has been shared with our team, and we genuinely appreciate the recognition of our representative's efforts. It's feedback like yours that motivates us to continually strive for excellence in customer service. We hope that you will also recommend us to others.
If you need anything else, please do not hesitate to contact us at your most convenient time. Have a nice day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
I never got the info that i needed but i dont think is was your fault but the person who wrecked in to e fault!
Hello MaryAnna,
Thank you for taking the time to give us a review. Please accept my apologies if we were not able to satisfy your needs. We want to change your experience and double-check the information you need. If you wish, we can schedule a call as soon as you are free, or you can reach out to us via email at askrecordsfinder@recordsfinder.com. Rest assured, we're here to help you.
We look forward to hearing from you. Have a great day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
I found the information was comprehensive. I wish I could have received a photo copy of my deed.
Hello Robert,
Thank you for taking the time to share your feedback and for your positive review. We're pleased to hear that you found the information comprehensive. Your satisfaction is important to us, and we appreciate your input.
Regarding your concern, as of the moment, a photocopy of your deed is not yet part of our service. In the meantime, please request access to needed records from your nearest DMV. If you need anything else, please do not hesitate to contact us at your most convenient time. Have a nice day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Didn't have everything I was looking for so that's where I'm at with this review
Hello Zachary,
Thank you for providing feedback. We apologize for any missing information and would like to assist you promptly. Please contact us via email at askrecordsfinder@ask.recordsfinder.com or call us at 833-922-2315. We are here to help and look forward to addressing your needs.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
This report on MYSELF was NOT requested by me. My phone & then identity were stolen end of February of this year. This was almost requested by the thief who helped himself to my banking account & various apps (Uber, Lyft, etc.). Please inform me re this "Wilfredo," who used my name & my $ to make this request,
Charles Schille
*******497
Hello Charles,
I'm truly sorry to hear about the distressing situation you've experienced. Identity theft is a serious matter. It's crucial to act swiftly in such cases. I'd recommend reporting this to the authorities to safeguard your identity. On our end, the account has been deactivated, and I've refunded the $2.95 fee. Please anticipate the refund to appear in your account within 3 to 5 business days.
If we can help you with anything else, we can schedule a call whenever you are available, or you can contact us via email at askrecordsfinder@ask.recordsfinder.com or call us at 833-922-2315. Please know that we are here to assist you. Take care!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Just needed one report and I got what I needed very quickly. Pretty plain and simple
Hello Nonya,
We're thrilled we could assist you swiftly! If you ever need more, we're here to help. Thank you for your feedback!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Flagged for checking on myself and family due t[car theft and identity theft. Which by the way the site is grossly inaccurate on everything
Hello Mason,
We're genuinely sorry to hear about your experience. Our primary goal is to provide accurate and reliable information, and we take such concerns seriously.
It is important to note that our records are meticulously gathered from publicly available sources. We make every effort to ensure accuracy, but given the nature of the sources, we can't guarantee the absolute accuracy of the information. It's essential to note that the materials and information we offer are presented "as is" and "as available," as we operate within the bounds of the data provided by these public sources, over which we have no direct control. I hope you understand.
If we can help you with anything else, we can schedule a call whenever you are available, or you can contact us via email at askrecordsfinder@ask.recordsfinder.com or call us at 833-922-2315. Please know that we are here to assist you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Good. The information was accurate and informative. The search was relatively easy. I would use the service again in the future.
Hello Elizabeth,
Thank you for the feedback! I'm pleased to hear that you had a positive experience with the service. We are here to provide assistance, so if you ever need to use the service again in the future or have any more questions, please don't hesitate to reach out. Your positive experience is important, and We are here to help you with any information or support you may need.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
While report was searching it said it had the name and other data. It did not show up on the regular report. For more information I was encouraged to buy the premium package for $9. Again no owners name on the report. These sites suck you in and don't give the information you are looking for. The cancellation process went smooth.
Hello John,
Thank you for your feedback. We apologize for the inconvenience. I searched on my end to see if I could help yield the results you may need, but I was unsuccessful. It could be that the license plate might be restricted access under the Driver’s Privacy Protection Act (DPPA) protection. I hope you understand.
Furthermore, I refunded the fee of $9.95. Please allow 3 -5 business days for the refund to reflect on your account. Please note your account is active. If you need to cancel any future charges please let us know.
If we can help you with anything else, we can schedule a call whenever you are available, or you can contact us via email at askrecordsfinder@ask.recordsfinder.com or call us at 833-922-2315. Please know that we are here to assist you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Ggjjccttfffyfcttffrrerhhfeegggrtgfewwfhiiydfvhfwwmhewfg
Hello Salvador,
It seems like you've provided a random sequence of letters and characters. Is there a specific question or topic you'd like me to address? Please provide more context, and I'll be happy to help. Please contact us at askrecordsfinder@ask.recordsfinder.com or call 833-922-2315. We look forward to hearing from you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Very satisfied customer rapid response all necessary information
Hello Barry,
We're delighted to hear that you're a very satisfied customer! We always strive to provide rapid responses and all the necessary information. If you have any more questions or need further assistance in the future, please don't hesitate to reach out. Thank you for your feedback!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
I needed plate search for title number.
Report given only contained information on the vehicle.
Hello Stephen,
Thank you for your feedback. We apologize for any inconvenience. I searched on my end but couldn't find the information you need. The license plate may be restricted under the DPPA. Our data is from publicly available records, which may have errors due to legal restrictions. I hope you understand.
If you need more help, please contact us at askrecordsfinder@ask.recordsfinder.com or call 833-922-2315. Your feedback is important, and we're here to assist you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
I thought I could see if I had any traffic violations over the plate but it only showed me the car information
Hello Juan,
Thank you for your review. We do apologize for the inconvenience. We can also check it by your name if you prefer. Please provide additional information by contacting us directly at askrecordsfinder@ask.recordsfinder.com or call us at 833-922-2315.
We will wait for your response. Please know that we are here to assist you. Have a good day!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
The information I received was not the information I asked for I asked for ownership So basically it was a waste of money and falls advertising
Hello Chris,
Thank you for your feedback. We apologize for the inconvenience. I searched on my end to see if I could help yield the results you may need, but I was unsuccessful. It could be that the license plate might be restricted access under the Driver’s Privacy Protection Act (DPPA) protection. I hope you understand.
Please note your account is active. If you need to cancel any future charges please let us know.
If we can help you with anything else, we can schedule a call whenever you are available. You can also contact us via email at askrecordsfinder@ask.recordsfinder.com or call us at
833-922-2315. Your satisfaction is our priority. Please know that we are here to assist you.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
Fast emailing / auto response. Hopefully answer my billing quick
Hello Andrea,
Thank you for reaching out to us! We are glad to know that you are happy with our quick cancellation process. We appreciate your prompt message regarding this. As much as possible we give importance to a swift resolution.
If you have any specific questions or any other concerns, please do not hesitate to reach out to us at askrecordsfinder@ask.recordsfinder.com or 833-922-2315. Your satisfaction is our priority.
Have a nice day!
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
In August of this year. I wanted to see if "Records Finder"was any good,so I tried it. I entered my required information. Within a few seconds. The screen showed my personal info. It recommended that I get a full report. I paid for a full report. I printed off my full report. I wasted about 20 pages of ink and paper for a report that read "not found" under every category! Unacceptable! That is not where it ends. Obviously, very disappointed, I Immediately canceled my subscription. I have been charged every month since then. "RIDICULOUS"
Hello Andrew,
We apologize for any inconvenience and understand your frustration. Please note that our database may not have all records due to variations in public record availability.
We couldn't find a prior cancellation request before 10/30/2023. If you made one, please provide relevant information to assist us.
Your request is important to us, and we take it seriously. To address your concerns in the interim, we've initiated a $24.95 refund, which may take 3-5 business days to reflect in your account. Rest assured your account is canceled.
For further assistance, please contact us at askrecordsfinder@ask.recordsfinder.com or 833-922-2315. We await your response.
Sincerely,
Ruby
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315
- Sitejabber’s sole mission is to increase online transparency for buyers and businesses
- Sitejabber has helped over 200M buyers make better purchasing decisions online
- Suspicious reviews are flagged by our algorithms, moderators, and community members
- Sitejabber’s sole mission is to increase online transparency for buyers and businesses
- Sitejabber has helped over 200M buyers make better purchasing decisions online
- Suspicious reviews are flagged by our algorithms, moderators, and community members
Hello Jose,
Thank you so much for taking the time to share your positive experience! We're thrilled to hear that you enjoyed using our service, and your kind words truly mean a lot to us. We hope you recommend us to others!
If you need anything else, please do not hesitate to contact us at your most convenient time. Have a nice day ahead, and stay safe!
Sincerely,
Zyra
Voice Of Customer Specialist
Recordsfinder.com
+1 833-922-2315